HPA014432

Anti-MSRB3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Methionine-R-sulfoxide reductase B3, mitochondrial precursor, Anti-MsrB3
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA014432
• NACRES: NA.43

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• immunogen sequence: QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC
• UniProt accession no.: Q8IXL7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MSRB3(253827)

Descripción

General description

The gene MSRB3 (methionine sulfoxide reductase B3) belongs to the Msr family consisting of MsrA, MsrB, and fRMsr. The MsrAs and MsrBs catalyze the reduction of methionine-S-sulfoxide and methionine-R-sulfoxide residues in proteins, while fRMsr is involved in the reduction of free methionine-R-sulfoxide. The MsrBs include there forms MsrB1, MsrB2, and MsrB3 in mammals. They contain Zn, coordinated by two CxxC motifs involved in the stabilization of MsrB structure. MsrB3, in turn, comprises of two isoforms MsrB3A and MsrB3B, produced by alternative first exon slicing. The gene is mapped to human chromosome 12q14.3.

Immunogen

Methionine-R-sulfoxide reductase B3, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-MSRB3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72630

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)