HPA011276
Anti-SSR1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Anti-SSR-alpha, Anti-Signal sequence receptor subunit alpha, Anti-TRAP-alpha, Anti-Translocon-associated protein subunit alpha precursor
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Seleccione un Tamaño
100 μL
MXP 11,020.00
MXP 11,020.00
Check Cart for Availability
Seleccione un Tamaño
Cambiar Vistas
100 μL
MXP 11,020.00
About This Item
MXP 11,020.00
Check Cart for Availability
origen biológico
rabbit
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
Formulario
buffered aqueous glycerol solution
reactividad de especies
rat, mouse, human
validación mejorada
independent
Learn more about Antibody Enhanced Validation
técnicas
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
secuencia del inmunógeno
ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... SSR1(6745)
Categorías relacionadas
Descripción general
SSR1 (signal sequence receptor, α) is an endoplasmic reticulum (ER) membrane protein, which is predominantly localized to rough ER. Its molecular weight is 34kDa. It is a type I membrane protein and is also found in the nuclear envelope. This gene is localized to human chromosome 6. It is also known as translocon-associated protein α (TRAPA) and is one of the four subunits making the TRAP complex.
Inmunógeno
Translocon-associated protein subunit alpha precursor recombinant protein epitope signature tag (PrEST)
Aplicación
Anti-SSR1 antibody produced in rabbit has been used in selective permeabilization immunofluorescence (2μg/ml).
Anti-SSR1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Acciones bioquímicas o fisiológicas
The function of SSR1 (signal sequence receptor, α) is not yet fully characterized. It is a calcium binding protein. It forms part of the translocon-associated protein (TRAP) complex, which is involved in the endoplasmic reticulum-associated degradation (ERAD) pathway. This protein is induced by granulocyte-macrophage colony-stimulating factor (GM-CSF), which might be an outcome of unfolded protein response due to the accumulation of improperly folded proteins. Also this gene is located in the schizophrenia susceptibility locus.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST71885
Forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Equipo de protección personal
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Martin S Taylor et al.
The Journal of biological chemistry, 288(45), 32211-32228 (2013-09-21)
Ghrelin O-acyltransferase (GOAT) is a polytopic integral membrane protein required for activation of ghrelin, a secreted metabolism-regulating peptide hormone. Although GOAT is a potential therapeutic target for the treatment of obesity and diabetes and plays a key role in other
Koji Nagasawa et al.
EMBO reports, 8(5), 483-489 (2007-03-24)
The mammalian translocon-associated protein (TRAP) complex comprises four transmembrane protein subunits in the endoplasmic reticulum. The complex associates with the Sec61 translocon, although its function in vivo remains unknown. Here, we show the involvement of the TRAP complex in endoplasmic
T Hirama et al.
FEBS letters, 455(3), 223-227 (1999-08-07)
The cloning of full length cDNA for the translocon-associated protein alpha subunit, previously called signal sequence receptor alpha, is reported as a result of differential display experiments in search of genes induced by granulocyte-macrophage colony-stimulating factor. Its messenger RNA was
E Hartmann et al.
FEBS letters, 349(3), 324-326 (1994-08-08)
The alpha-subunit of the TRAP complex (TRAP alpha) is a single-spanning membrane protein of the endoplasmic reticulum (ER) which is found in proximity of nascent polypeptide chains translocating across the membrane. Here, we demonstrate the widespread occurrence of TRAP alpha
F Vogel et al.
European journal of cell biology, 53(2), 197-202 (1990-12-01)
The signal sequence receptor (SSR), an integral membrane glycoprotein of 34 kDa, has previously been shown to be a component of the molecular environment which nascent polypeptide chains meet in passage through the endoplasmic reticulum (ER) membrane. We have used
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
