HPA008716

Anti-RNF14 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Androgen receptor-associated protein 54, Anti-E3 ubiquitin-protein ligase RNF14, Anti-HFB30, Anti-RING finger protein 14, Anti-Triad2 protein
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA008716
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human, rat, mouse
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• secuencia del inmunógeno: GCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEV
• Nº de acceso UniProt: Q9UBS8
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... RNF14(9604)

Descripción

Descripción general

RNF14 (ring finger protein 14) is a ligand-dependent androgen receptor (AR)-associated protein and is also called ARA54. It has a molecular weight of 54kDa and is composed of 474 amino acids. Its middle portion contains RING finger or zinc finger motif, which is rich in cysteine. Downstream to the RING finger motif, it contains another cysteine-rich region similar to B-box. This protein might be the representative of a new subgroup of the B-box RING finger protein family. Its mRNA has the highest expression in testis, followed by thymus, spleen, colon, prostate, uterus, small intestine, and leukocytes of blood. This gene is localized to human chromosome 5q23.3-q31.1.

Inmunógeno

E3 ubiquitin-protein ligase RNF14 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

RNF14 (ring finger protein 14), along with ARA70 or SRC-1 (steroid receptor coactivator), co-activates AR (androgen receptor), and acts as the preferred AR activator in prostate cancer DU145 cells. Thus, it might have an important role in AR-signaling pathway in prostate. It acts as an activator of cyclin D1, which promotes the progression of cell cycle and cell proliferation in human tumor cells. This protein acts as a positive regulator of Wnt signaling in cancer cells, and is essential for colon cancer cell survival. It also acts as a regulator of T-cell factor/lymphoid enhancer factor (TCF/LEF), which in turn control transcription through the recruitment of β-catenin. Spermatogenesis and testicular development in humans is regulated by the localization patter on RNF14 protein, and this protein is down-regulated in non-obstructive azoospermia.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86694

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)