Saltar al contenido
Merck

HPA006314

Sigma-Aldrich

Anti-PARN antibody produced in rabbit

enhanced validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Deadenylating nuclease antibody produced in rabbit, Anti-Deadenylation nuclease antibody produced in rabbit, Anti-Poly(A)-specific ribonuclease PARN antibody produced in rabbit, Anti-Polyadenylate-specific ribonuclease antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 12,107.00

MXP 12,107.00


Fecha estimada de envío01 de mayo de 2025



Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 12,107.00

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

MXP 12,107.00


Fecha estimada de envío01 de mayo de 2025


origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human, mouse, rat

validación mejorada

independent
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

DGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGA

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PARN(5073)

¿Está buscando productos similares? Visita Guía de comparación de productos

Descripción general

Poly(A)-specific ribonuclease (PARN) is a 3′- exoribonuclease found in mammals. It is a member of the DEDD (death effector domain-containing protein) family of nucleases, and is a divalent metal-ion dependent enzyme. It is divided into three structural domains, with the nuclease domain harboring the active site. This protein also contains RNA-recognition motif (RRM) and the R3H domain, which function as RNA-binding domains. This gene is localized to human chromosome 16p13.

Inmunógeno

Poly(A)-specific ribonuclease PARN recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Poly(A)-specific ribonuclease (PARN) is one of the rare mammalian exonucleases that has a high specificity for poly(A) degradation. It interacts with both the poly(A) tail and with the 5′ end-located cap-structure. It is a highly processive enzyme as its interaction with 5′-end cap enhances its rate of degradation. This protein is up-regulated in gastric cancer, and its inactivation results in cell cycle arrest, thus, inhibiting the proliferation of gastric cancer cells.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70834

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

K Buiting et al.
Cytogenetics and cell genetics, 87(1-2), 125-131 (2000-01-21)
The deadenylation nuclease or poly(A)-specific ribonuclease (PARN) is a 3' exonuclease, which degrades the poly(A)-tail of eukaryotic mRNA molecules. By DNA sequence analysis of cDNA and genomic clones, fluorescence in situ hybridization, and reverse transcriptase-PCR, we have determined that the
Niklas Henriksson et al.
The Journal of biological chemistry, 285(1), 163-170 (2009-11-11)
Poly(A)-specific ribonuclease (PARN) is a mammalian 3'-exoribonuclease that degrades poly(A) with high specificity. To reveal mechanisms by which poly(A) is recognized by the active site of PARN, we have performed a kinetic analysis using a large repertoire of trinucleotide substrates.
Li-Na Zhang et al.
Biochimica et biophysica acta, 1853(2), 522-534 (2014-12-17)
Regulation of mRNA decay plays a crucial role in the post-transcriptional control of cell growth, survival, differentiation, death and senescence. Deadenylation is a rate-limiting step in the silence and degradation of the bulk of highly regulated mRNAs. However, the physiological

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico