Saltar al contenido
Merck

HPA005768

Sigma-Aldrich

Anti-ETV4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-E1A-F, Anti-E1AF, Anti-PEA3, ETV4 Antibody - Anti-ETV4 antibody produced in rabbit, Etv4 Antibody

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

YLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ETV4(2118)

General description

ETS translocation variant 4 (ETV4) gene is mapped to human chromosome 17q21.31. It is also called Polyoma enhancer activator 3 (PEA3) and it belongs to E26 transformation-specific (ETS) transcription factor family with conserved DNA binding domain (ETS binding domain).

Immunogen

ETS translocation variant 4 recombinant protein epitope signature tag (PrEST)

Application

Anti-ETV4 antibody produced in rabbit has been used in the immunohistochemical analyses.

Biochem/physiol Actions

ETS translocation variant 4 (ETV4) mediates the transcriptional activation of extracellular signal-regulated kinases or the mitogen-activated protein (ERK MAP) kinase pathway. Sumoylation of ETV4 is implicated in colon cancer cells. ETV4 is oncogenic as it promotes tumor progression. It promotes proliferation in prostate tumor. It also mediates the proliferation and differentiation of embryonic stem cells.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84717

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Synthetic transactivation screening reveals ETV4 as broad coactivator of hypoxia-inducible factor signaling
Wollenick K, et al.
Nucleic Acids Research, 40(5), 1928-1943 (2011)
ETS-related transcription factors ETV4 and ETV5 are involved in proliferation and induction of differentiation-associated genes in embryonic stem (ES) cells
Akagi T, et al.
The Journal of Biological Chemistry, 290(37), 22460-22473 (2015)
EWSR1-NFATC2 Translocation-associated Sarcoma Clinicopathologic Findings in a Rare Aggressive Primary Bone or Soft Tissue Tumor.
Wang GY, et al.
The American journal of surgical pathology (2019)
Overexpression of ETV4 is oncogenic in prostate cells through promotion of both cell proliferation and epithelial to mesenchymal transition
Pellecchia A, et al.
Oncogenesis, 1(7), e20-e20 (2012)
Extracellular signal-regulated kinase mitogen-activated protein kinase signaling initiates a dynamic interplay between sumoylation and ubiquitination to regulate the activity of the transcriptional activator PEA3
Guo B and Sharrocks AD
Molecular and Cellular Biology, 29(11), 3204-3218 (2009)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico