Saltar al contenido
Merck
Todas las fotos(3)

Documentos

HPA005437

Sigma-Aldrich

Anti-BIN1 antibody produced in rabbit

enhanced validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Amphiphysin II antibody produced in rabbit, Anti-Amphiphysin-like protein antibody produced in rabbit, Anti-Box-dependent myc-interacting protein 1 antibody produced in rabbit, Anti-Bridging integrator 1 antibody produced in rabbit, Anti-Myc box-dependent-interacting protein 1 antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50-1:200

immunogen sequence

VTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BIN1(274)

¿Está buscando productos similares? Visita Guía de comparación de productos

General description

Bridging integrator-1 (BIN1), also called amphiphysin II, is a nucleocytoplasmic protein which is ubiquitously expressed. It is a ligand to the transcription factor Myc and also interacts with SRC SH3, which is a tyrosine kinase ligand. Amphiphysin II is a member of the amphiphysin family, along with amphiphysin I. Depending upon the cell type, human BIN1 gene is alternatively spliced. In humans, BIN1 gene is located on chromosome 2q14 and has 20 exons. Gene splicing leads to various isoforms, of which isoform 8 is found in skeletal muscles, 1 to 7 in brain and 9 and 10 are expressed ubiquitously. It is also called SH3P9, and has an N-BAR (Bin-amphiphysin/Rvs) domain, a phosphoinositide (PI) binding motif, clathrin and AP2 (CLAP) binding domain, Myc-binding domain (MBD) as well as SRC homology 3 domain.

Immunogen

Myc box-dependent-interacting protein 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The N-terminal BAR domain of Bridging integrator-1 (BIN1) is responsible for the regulation of membrane curvature sensing and generation (MC-S&G). This function of BIN1, in turn is regulated and auto-inhibited by the PI binding motif and the SH3 domain, which recruit downstream proteins such as dynamin-2. It interacts with Myc oncoproteins and acts as a tumor suppressor gene, and therefore, its expression is reduced in cancer cells. BIN1 also mediates endocytosis in brain by binding to AP2 and clathrin, which are endocytic proteins. BIN1 mediates endocytosis, cell migration, and endosomal sorting through membrane remodeling. This is achieved via its N-BAR domain, which mediates the formation of plasma membrane invaginations (T-tubules) in muscles. Centronuclear myopathy (CNM) has been linked to 3 mutations in the N-BAR gene, namely, K35N, D151N and R154Q. It has also been linked to late-onset Alzheimer′s disease and heart failure.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70745

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Optional

Referencia del producto
Descripción
Precios

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Ivana Prokic et al.
Journal of molecular medicine (Berlin, Germany), 92(5), 453-463 (2014-03-05)
Amphiphysin 2, also named bridging integrator-1 (BIN1) or SH3P9, has been recently implicated in rare and common diseases affecting different tissues and physiological functions. BIN1 downregulation is linked to cancer progression and also correlates with ventricular cardiomyopathy and arrhythmia preceding
Tingting Wu et al.
PloS one, 9(4), e93060-e93060 (2014-04-24)
The regulation of membrane shapes is central to many cellular phenomena. Bin/Amphiphysin/Rvs (BAR) domain-containing proteins are key players for membrane remodeling during endocytosis, cell migration, and endosomal sorting. BIN1, which contains an N-BAR domain, is assumed to be essential for
Tingting Wu et al.
Biochemistry, 53(46), 7297-7309 (2014-10-29)
In striated muscles, invaginations from the plasma membrane, termed transverse tubules (T-tubule), function in the excitation-contraction coupling machinery. BIN1 (isoform8) plays a critical role in the biogenesis of T-tubules. BIN1 contains an N-terminal BAR domain to sense and induce membrane

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico