HPA001825

Anti-DIABLO antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Diablo homolog, mitochondrial precursor, Anti-Direct IAP-binding protein with low pI, Anti-Second mitochondria-derived activator of caspase, Anti-Smac protein
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA001825
• NACRES: NA.41

Propiedades

• biological source: rabbit
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• immunogen sequence: AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG
• UniProt accession no.: Q9NR28
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DIABLO(56616)

Descripción

Immunogen

Diablo homolog, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

DIABLO (diablo IAP-binding mitochondrial protein) is a pro-apoptotic, mitochondrial protein involved with apoptosis (programmed cell death). Specifically, it is associated with the caspase activation in cytochrome c/APAF-1 (apoptotic peptidase activating factor 1)/caspase-9 pathway. It is involved in the neutralization of one or more members of the IAPs (inhibitor of apoptosis proteins) family of apoptosis inhibitory proteins. At the time of apoptosis, it travels from mitochondria to cytosol which is triggered by pro-apoptotic agents such as UV or γ-irradiation, cytotoxic drugs and by ligation of the CD95 death receptor. During mitochondrial transport, the N-terminus of DIABLO is proteolytically cleaved to transform into mature dimer form as well as to exhibit pro-apoptotic activity. Overexpression of DIABLO increases cell sensitivity to apoptotic stimuli.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86234

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)