Saltar al contenido
Merck

HPA001566

Sigma-Aldrich

Anti-CYB5R3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-B5R antibody produced in rabbit, Anti-Cytochrome b5 reductase 3 antibody produced in rabbit, Anti-Diaphorase-1 antibody produced in rabbit, Anti-NADH-cytochrome b5 reductase antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 11,020.00

MXP 11,020.00


Check Cart for Availability


Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 11,020.00

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

MXP 11,020.00


Check Cart for Availability

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

secuencia del inmunógeno

SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CYB5R3(1727)

Inmunógeno

NADH-cytochrome b5 reductase recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-CYB5R3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting.[1] To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Acciones bioquímicas o fisiológicas

CYB5R3 (cytochrome b5 reductase 3) gene encodes cytochrome b5 reductase that may be either in the membrane-bound form in somatic cell or in the soluble form in erythrocytes. The membrane-bound form is found anchored to the ER and is involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, and in drug metabolism. It has both membrane-binding and catalytic domains. The soluble form has only the catalytic domain and functions in methemoglobin reduction. It is involved in the regulation of NAD+/NADH ratio, in turn affecting aerobic metabolism and aging processes. Defects in this gene cause methemoglobinemias.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73379

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Heyka H Jakobs et al.
PloS one, 9(8), e105371-e105371 (2014-08-22)
The mitochondrial amidoxime reducing component mARC is the fourth mammalian molybdenum enzyme. The protein is capable of reducing N-oxygenated structures, but requires cytochrome b5 and cytochrome b5 reductase for electron transfer to catalyze such reactions. It is well accepted that
Sophia Rixen et al.
The Journal of biological chemistry, 294(46), 17593-17602 (2019-09-27)
The mitochondrial amidoxime-reducing component (MARC) is a mammalian molybdenum-containing enzyme. All annotated mammalian genomes harbor two MARC genes, MARC1 and MARC2, which share a high degree of sequence similarity. Both molybdoenzymes reduce a variety of N-hydroxylated compounds. Besides their role
Rafael de Cabo et al.
Aging, 2(1), 63-68 (2009-01-01)
Aging results from a complex and not completely understood chain of processes that are associated with various negative metabolic consequences and ultimately leads to senescence and death. The intracellular ratio of pyridine nucleotides (NAD(+)/NADH), has been proposed to be at
Sidse Ehmsen et al.
Cell reports, 27(13), 3927-3938 (2019-06-27)
Tumor eradication may be greatly improved by targeting cancer stem cells (CSCs), as they exhibit resistance to conventional therapy. To gain insight into the unique biology of CSCs, we developed patient-derived xenograft tumors (PDXs) from ER- breast cancers from which

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico