Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV54594

Sigma-Aldrich

Anti-ARCN1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Archain 1, Anti-COPD

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

57 kDa

reactividad de especies

dog, mouse, bovine, human, guinea pig, rat

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ARCN1(372)

Inmunógeno

Synthetic peptide directed towards the middle region of human ARCN1

Aplicación

Anti-ARCN1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Acciones bioquímicas o fisiológicas

ARCN1 gene encodes an intracellular protein, which is the δ subunit of coat protein I (COPI) complex and is localized on chromosome 11 at 11q23.3. It is a 57kD protein consisting of C-terminal domain (CTD) and an N-­terminal longin domain. The encoded protein facilitates the retrograde transport of proteins and lipids from the cis-Golgi network to the endoplasmic reticulum and intra-Golgi membranes. Single nucleotide polymorphism in ARCN1 gene increases the risk of Glioma.

Secuencia

Synthetic peptide located within the following region: GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kai Deng et al.
Acta crystallographica. Section F, Structural biology and crystallization communications, 68(Pt 7), 829-831 (2012-07-04)
Coat protein I (COPI) is a protein complex composed of seven subunits that mediates retrograde transport of proteins and lipids from the cis-Golgi network to the endoplasmic reticulum and intra-Golgi membranes. The medium-sized δ subunit of COPI (δ-COP) is a
Hongyan Chen et al.
PloS one, 7(12), e52864-e52864 (2013-01-10)
A single nucleotide polymorphism (SNP) at locus 11q23.3 (rs498872) in the near 5'-UTR of the PHLDB1 gene was recently implicated as a risk factor for gliomas in a genome-wide association study, and this involvement was confirmed in three additional studies.
Todd D Taylor et al.
Nature, 440(7083), 497-500 (2006-03-24)
Chromosome 11, although average in size, is one of the most gene- and disease-rich chromosomes in the human genome. Initial gene annotation indicates an average gene density of 11.6 genes per megabase, including 1,524 protein-coding genes, some of which were

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico