Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV53829

Sigma-Aldrich

Anti-PAOX (AB2) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Polyamine oxidase (exo-N4-amino)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.43

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

25 kDa

reactividad de especies

horse, dog, mouse, rat, rabbit, human, bovine

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PAOX(196743)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human PAOX

Aplicación

Anti-PAOX (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Acciones bioquímicas o fisiológicas

PAOX [polyamine oxidase (exo-N4-amino)] encodes a FAD containing enzyme that catalyzes the oxidation of N(1)-acetylspermine and N1-acetylspermidine to spermidine and putrescine, respectively. It is, therefore, involved in the polyamine back-conversion. It also facilitates the regulation of polyamine intracellular concentration.

Secuencia

Synthetic peptide located within the following region: LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

G Bjelakovic et al.
Molecular and cellular biochemistry, 341(1-2), 79-85 (2010-04-21)
Diabetes mellitus is a metabolic disease characterized by inadequate secretion of insulin. Polyamine oxidase (PAO), a FAD-containing enzyme is involved in the biodegradation of Sp and Spd, catalyzing the oxidative deamination of Sp and Spd, resulting in production of ammonia
Aki Järvinen et al.
The Journal of biological chemistry, 281(8), 4589-4595 (2005-12-16)
FAD-dependent polyamine oxidase (PAO; EC 1.5.3.11) is one of the key enzymes in the catabolism of polyamines spermidine and spermine. The natural substrates for the enzyme are N1-acetylspermidine, N1-acetylspermine, and N1,N12-diacetylspermine. Here we report that PAO, which normally metabolizes achiral

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico