AV49811
Anti-LENG4 antibody produced in rabbit
IgG fraction of antiserum
Sinónimos:
Anti-BB1
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Productos recomendados
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
53 kDa
species reactivity
horse, dog, human, pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LENG4(79143)
Categorías relacionadas
General description
Membrane bound O-acyltransferase domain containing 7 (MBOAT7; LENG4; LPLAT7) belongs to membrane-bound O-acyltransferase (MBOAT) family. The protein shows an endoplasmic reticulum-like reticular pattern and perinuclear staining in HEK293 cells.
Immunogen
Synthetic peptide directed towards the C terminal region of human LENG4
Application
Anti-LENG4 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml. The antibody has been used for western blotting for proteins isolated from mice brain tissue.
Biochem/physiol Actions
Membrane bound O-acyltransferase domain containing 7 (MBOAT7; LENG4) is an integral membrane protein important for reacylation of phospholipids. The reacylation is an important step in the recycling of phospholipids via the Land cycle. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. LENG4 interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.
Sequence
Synthetic peptide located within the following region: LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Miriam Longo et al.
Cellular and molecular gastroenterology and hepatology, 13(3), 759-788 (2021-11-26)
The I148M Patatin-like Phospholipase Domain-containing 3 (PNPLA3), the rs641738 in the Membrane bound O-acyltransferase domain containing 7-transmembrane channel-like 4 (MBOAT7-TMC4) locus, and the E167K Transmembrane 6 Superfamily Member 2 (TM6SF2) polymorphisms represent the main predisposing factors to nonalcoholic fatty liver disease
Karen E Anderson et al.
PloS one, 8(3), e58425-e58425 (2013-03-09)
We disrupted the gene encoding lysophosphatidylinositol-acyltransferase-1 (LPIAT1) in the mouse with the aim of understanding its role in determining cellular phosphoinositide content. LPIAT1(-/-) mice were born at lower than Mendelian ratios and exhibited a severe developmental brain defect. We compared
Yusuke Hirata et al.
Genes to cells : devoted to molecular & cellular mechanisms, 18(5), 397-409 (2013-03-21)
Lysophosphatidylinositol acyltransferase 1 (LPIAT1), also known as MBOAT7, is a phospholipid acyltransferase that selectively incorporates arachidonic acid (AA) into the sn-2 position of phosphatidylinositol (PI). We previously demonstrated that LPIAT1 regulates AA content in PI and plays a crucial role
Hideo Shindou et al.
Journal of lipid research, 50 Suppl, S46-S51 (2008-10-22)
Cells of all organisms are enclosed by a plasma membrane containing bipolar lipids, cholesterol, and proteins. Cellular membranes contain several classes of glycerophospholipids, which have numerous structural and functional roles in cells. Polyunsaturated fatty acids including arachidonic acid and eicosapentaenoic
Miguel A Gijón et al.
The Journal of biological chemistry, 283(44), 30235-30245 (2008-09-06)
The cycle of deacylation and reacylation of phospholipids plays a critical role in regulating availability of arachidonic acid for eicosanoid production. The major yeast lysophospholipid acyltransferase, Ale1p, is related to mammalian membrane-bound O-acyltransferase (MBOAT) proteins. We expressed four human MBOATs
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico