Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

AV49458

Sigma-Aldrich

Anti-TRPV5 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-CAT2, Anti-ECAC1, Anti-OTRPC3, Anti-Transient receptor potential cation channel, subfamily V, member 5

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

82 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TRPV5(56302)

Descripción general

Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) belongs to transient receptor potential (TRP) cation channels family. All TRP channels contain transmembrane helices and CaM (calmodulin) binding sites. TRPV5 is highly expressed in kidney, small intestine and pancreas. Low levels of TRPV5 are observed in testis, prostate, placenta, brain, colon and rectum. TRPV5 has also been reported in human parathyroid glands.[1] The protein mianly localizes at the plasma membrane.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TRPV5

Aplicación

Anti-TRPV5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) is an epithelial transmembrane calcium-selective channel. TRPV5 mediates renal calcium reabsorption[2] and mutations in this gene result in hypercalciuria.[3] TRPV5 also controls levels of cadmium and zinc in cells. WNK3, the With No Lysine (K) family membre, positively regulate TRPV5.

Secuencia

Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

12 - Non Combustible Liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Laura Giusti et al.
Journal of cellular and molecular medicine, 18(10), 1944-1952 (2014-08-29)
The parathyroid glands play an overall regulatory role in the systemic calcium (Ca(2+)) homeostasis. The purpose of the present study was to demonstrate the presence of the Ca(2+) channels transient receptor potential vanilloid (TRPV) 5 and TRPV6 in human parathyroid
Gergely Kovacs et al.
Cell calcium, 54(4), 276-286 (2013-08-24)
TRPV5 and TRPV6 are two major calcium transport pathways in the human body maintaining calcium homeostasis. TRPV5 is mainly expressed in the distal convoluted and connecting tubule where it is the major, regulated pathway for calcium reabsorption. TRPV6 serves as
Zhaohua Guo et al.
PloS one, 8(2), e58174-e58174 (2013-03-08)
TRPML3 and TRPV5 are members of the mucolipin (TRPML) and TRPV subfamilies of transient receptor potential (TRP) cation channels. Based on sequence similarities of the pore forming regions and on structure-function evidence, we hypothesized that the pore forming domains of
Olena Andrukhova et al.
The EMBO journal, 33(3), 229-246 (2014-01-18)
αKlotho is thought to activate the epithelial calcium channel Transient Receptor Potential Vanilloid-5 (TRPV5) in distal renal tubules through its putative glucuronidase/sialidase activity, thereby preventing renal calcium loss. However, αKlotho also functions as the obligatory co-receptor for fibroblast growth factor-23
D Müller et al.
Genomics, 67(1), 48-53 (2000-08-17)
Functional and morphological analyses indicated that the epithelial Ca2+ channel (ECaC), which was recently cloned from rabbit kidney, exhibits the defining properties for being the gatekeeper in transcellular Ca2+ (re)absorption. Its human homologue provides, therefore, a molecular basis for achieving

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico