Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV48157

Sigma-Aldrich

Anti-RPL3 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-MGC104284, Anti-Ribosomal protein L3, Anti-TARBP-B

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
El producto AV48157 no se vende actualmente en su país Póngase en contacto con el Servicio técnico

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

40 kDa

reactividad de especies

rat, bovine, rabbit, guinea pig, horse, human, dog, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... RPL3(6122)

Descripción general

Ribosomal protein L3 is a cytoplasmic protein that can bind to HIV-1 TAR mRNA and modulated transactivation mediated by Tat. Studies have reported that the autoregulatory circuit of RPL3 required KHSRO, NPM and H1 proteins[1]. RPL3 gene is also known to be overexpressed in obesity models[2].
Rabbit Anti-RPL3 antibody recognizes human, mouse, rat, zebrafish, chicken, pig, and bovine RPL3.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human RPL3

Aplicación

Rabbit Anti-RPL3 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Acciones bioquímicas o fisiológicas

Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. This gene is co-transcribed with several small nucleolar RNA genes, which are located in several of this gene′s introns. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Secuencia

Synthetic peptide located within the following region: YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Annapina Russo et al.
Nucleic acids research, 39(17), 7576-7585 (2011-06-28)
Alternative pre-mRNA splicing (AS) is a major mechanism that allows proteomic variability in eukaryotic cells. However, many AS events result in mRNAs containing a premature termination codon, which are degraded by nonsense-mediated mRNA decay (NMD) pathway. We have previously demonstrated
M F Allan et al.
Animal biotechnology, 12(2), 167-171 (2002-01-26)
The ribosomal protein 3 gene is differentially expressed in hypothalamus and brown adipose tissue between mouse lines divergently selected for heat loss, and in skeletal muscle of the ob/ob mouse model. Unfortunately, multiple Rpl3-processed pseudogenes have hampered mapping of the

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico