Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV46950

Sigma-Aldrich

Anti-ST6GALNAC6 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-RP11-203J24.3, Anti-SIAT7F, Anti-ST6 -N-acetylgalactosaminide α-2,6-sialyltransferase 6, Anti-ST6GALNACVI

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

38 kDa

reactividad de especies

rabbit, dog, guinea pig, horse, human, rat, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

Inmunógeno

Synthetic peptide directed towards the C terminal region of human ST6GALNAC6

Aplicación

Anti-ST6GALNAC6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Acciones bioquímicas o fisiológicas

ST6GALNAC6 [ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6] gene encodes a single-pass type II membrane protein that belongs to glycosyltransferase 29 family and is primarily expressed in kidney, in proximal tubule epithelial cells and colon cell lines. It plays a crucial role in biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. It is also involved in the synthesis of disialyl Lewis a (Lea).

Secuencia

Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Akiko Tsuchida et al.
The Journal of biological chemistry, 278(25), 22787-22794 (2003-04-02)
Biosynthesis of disialyl Lewis a (Lea) was analyzed using previously cloned ST6GalNAc V and ST6GalNAc VI, which were responsible for the synthesis of alpha-series gangliosides. Among lactotetraosylceramide (Lc4), neolactotetraosylceramide, and their sialyl forms, only sialyl Lc4 was sialylated with ST6GalNAc
Motohiro Senda et al.
The Biochemical journal, 402(3), 459-470 (2006-11-25)
Although disialyl glycosphingolipids such as GD3 and GD2 have been considered to be associated with malignant tumours, whether branched-type disialyl glycosphingolipids show such an association is not well understood. We investigated the sialyltransferases responsible for the biosynthesis of DSGG (disialylgalactosylgloboside)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico