Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV46881

Sigma-Aldrich

Anti-LETM1 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Leucine zipper-EF-hand containing transmembrane protein 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

60 kDa

reactividad de especies

dog, mouse, horse, guinea pig, bovine, human, rat

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... LETM1(3954)

Inmunógeno

Synthetic peptide directed towards the middle region of human LETM1

Aplicación

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

Acciones bioquímicas o fisiológicas

LETM1 (leucine zipper-EF-hand containing transmembrane protein 1) gene encodes a single-pass membrane protein localized in the inner mitochondrial membrane. It plays a pivotal role in maintaining the mitochondrial tubular shape as well as cristae organization. It also facilitates the normal mitochondrial morphology and cellular viability. Mutation in LETM1 gene leads to Wolf-Hirschhorn syndrome.

Secuencia

Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kai Stefan Dimmer et al.
Human molecular genetics, 17(2), 201-214 (2007-10-11)
Wolf-Hirschhorn syndrome (WHS) is a complex congenital syndrome caused by a monoallelic deletion of the short arm of chromosome 4. Seizures in WHS have been associated with deletion of LETM1 gene. LETM1 encodes for the human homologue of yeast Mdm38p
Xiaogang Zhang et al.
Cerebral cortex (New York, N.Y. : 1991), 24(10), 2533-2540 (2013-05-07)
Leucine zipper-EF-hand containing transmembrane protein 1 (Letm1) is a mitochondrial protein that is associated with seizure attacks in Wolf-Hirschhorn syndrome. This study aimed to investigate the expression pattern of Letm1 in patients with temporal lobe epilepsy (TLE) and pilocarpine-induced rat
Shoko Tamai et al.
Journal of cell science, 121(Pt 15), 2588-2600 (2008-07-17)
LETM1 is located in the chromosomal region that is deleted in patients suffering Wolf-Hirschhorn syndrome; it encodes a homolog of the yeast protein Mdm38 that is involved in mitochondrial morphology. Here, we describe the LETM1-mediated regulation of the mitochondrial volume

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico