Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV46751

Sigma-Aldrich

Anti-VAMP5 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Vesicle-associated membrane protein 5 (Myobrevin)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 9,619.00

MXP 9,619.00


Fecha estimada de envío23 de abril de 2025



Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 9,619.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

MXP 9,619.00


Fecha estimada de envío23 de abril de 2025


origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

13 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... VAMP5(10791)

Inmunógeno

Synthetic peptide directed towards the middle region of human VAMP5

Aplicación

Anti-VAMP5 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

Acciones bioquímicas o fisiológicas

VAMP5 (vesicle-associated membrane protein 5) gene encodes a 116 amino acid containing single-pass type IV membrane protein that belongs to the synaptobrevin family and the SNARE superfamily. It plays a pivotal role vesicle trafficking events that are associated with myogenesis like- myoblast fusion and/or GLUT4 trafficking. VAMP5 protein is localized in skeletal muscle, heart, spleen, lung, liver, and kidney tissue and facilitates the membrane trafficking in skeletal and cardiac muscle.

Secuencia

Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Maiko Takahashi et al.
Histochemistry and cell biology, 139(4), 573-582 (2012-11-28)
Vesicle-associated membrane protein 5 (VAMP5) is a member of the SNARE protein family, which is generally thought to regulate the docking and fusion of vesicles with their target membranes. This study investigated the expression and localization of the VAMP5 protein.
Q Zeng et al.
Molecular biology of the cell, 9(9), 2423-2437 (1998-09-03)
cDNA clones encoding a novel protein (VAMP5) homologous to synaptobrevins/VAMPs are detected during database searches. The predicted 102-amino acid VAMP5 harbors a 23-residue hydrophobic region near the carboxyl terminus and exhibits an overall amino acid identity of 33% with synaptobrevin/VAMP1

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico