Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV44138

Sigma-Aldrich

Anti-SLCO6A1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-GST, Anti-MGC26949, Anti-OATP6A1, Anti-OATPY, Anti-Solute carrier organic anion transporter family, member 6A1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

79 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_775759

Nº de acceso UniProt

Q86UG4

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... SLCO6A1(133482)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SLCO6A1

Aplicación

Anti-SLCO6A1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Acciones bioquímicas o fisiológicas

SLCO6A1 (GST) is an organic anion transporter expressed strongly in testis and weakly in brain (adult and fetal), placenta and spleen. It is a putative cancer/testis (CT) cell surface antigen that might serve as a marker in medulloblastoma.

Secuencia

Synthetic peptide located within the following region: CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC14524

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Sueli M Oba-Shinjo et al.
Cancer immunity, 8, 7-7 (2008-04-23)
Medulloblastoma is the most common childhood malignant tumor of the central nervous system. Treatment of medulloblastoma requires harmful therapy and nevertheless carries a poor prognosis. Due to their presence in various cancers and their limited expression in normal tissues, CT
Sang-Yull Lee et al.
Cancer immunity, 4, 13-13 (2004-11-18)
Serological analysis of recombinant cDNA expression libraries (SEREX) has led to the identification of many of the antigens recognized by the immune system of cancer patients, which are collectively referred to as the cancer immunome. We used SEREX to screen

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico