Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV43761

Sigma-Aldrich

Anti-SLC25A25 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-KIAA1896, Anti-MCSC, Anti-MGC105138, Anti-PCSCL, Anti-SCAMC-2, Anti-Solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

55 kDa

reactividad de especies

horse, human, bovine, dog, rabbit, guinea pig, rat, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_001006642

Nº de acceso UniProt

Q6KCM6

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC25A25(114789)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SLC25A25

Acciones bioquímicas o fisiológicas

SLC25A25 is a member of family of calcium-binding mitochondrial carriers located in the inner membranes of mitochondria. It is ATP-Mg/Pi carrier and regulates the movement of adenine nucleotides in mitochondria. SLC25A25 maintains the homeostasis of ATP and Ca+2 cycling in the skeletal muscle.

Secuencia

Synthetic peptide located within the following region: AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC13987

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Rea P Anunciado-Koza et al.
The Journal of biological chemistry, 286(13), 11659-11671 (2011-02-08)
An ATP-Mg(2+/)P(i) inner mitochondrial membrane solute transporter (SLC25A25), which is induced during adaptation to cold stress in the skeletal muscle of mice with defective UCP1/brown adipose tissue thermogenesis, has been evaluated for its role in metabolic efficiency. SLC25A25 is thought
Araceli del Arco et al.
The Journal of biological chemistry, 279(23), 24701-24713 (2004-04-01)
Aralar1 and citrin were identified as calcium binding aspartate/glutamate carriers (AGC) in mitochondria. The presence of calcium binding motifs facing the extramitochondrial space allows the regulation of the transport activity of these carriers by cytosolic calcium and provides a new

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico