Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV42708

Sigma-Aldrich

Anti-SLC22A7 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-MGC24091, Anti-MGC45202, Anti-NLT, Anti-OAT2, Anti-Solute carrier family 22 (organic anion transporter), member 7

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 10,938.00

MXP 10,938.00


Fecha estimada de envío28 de mayo de 2025



Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 10,938.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

MXP 10,938.00


Fecha estimada de envío28 de mayo de 2025


origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

26 kDa

reactividad de especies

human, rabbit, rat, mouse, horse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC22A7(10864)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human SLC22A7

Acciones bioquímicas o fisiológicas

SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.

Secuencia

Synthetic peptide located within the following region: LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Zuzana Kadova et al.
American journal of physiology. Renal physiology, 308(5), F388-F399 (2014-12-17)
The aim of our study was to investigate whether two potent anti-inflammatory agents, dexamethasone and anakinra, an IL-1 receptor antagonist, may influence acute kidney injury (AKI) and associated drug excretory functions during endotoxemia (LPS) in rats. Ten hours after LPS

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico