AV37665

Anti-GPC3 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Glypican 3
• Código UNSPSC: 12352203

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: lyophilized powder
• mol peso: 64 kDa
• reactividad de especies: guinea pig, horse, canine, rat, mouse, rabbit, bovine, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_004475
• Nº de acceso UniProt: P51654
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... GPC3(2719)

Descripción

Descripción general

Glypican 3 (GPC3), whose gene is associated with Simpson-Golabi-Behmel syndrome, is a heparin sulfate proteoglycan that is anchored to cell-surfaces via glycosylphosphatidylinositol (GPI). Overexpression of glypican 3 occurs in hepatocellular carcinomas (HCC). The silencing of glypican 3 expression leads to apoptosis in HCC.

Especificidad

Anti-GPC3 polyclonal antibody reacts with canine, bovine, human, mouse, and rat glypican 3 proteins.

Inmunógeno

The immunogen for anti-GPC3 antibody: synthetic peptide derected towards the middle region of human GPC3

Aplicación

Anti-GPC3 polyclonal antibody is used to tag glypican 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe in cancer diagnosis to detect the presence of glypican 3 in hepatocellular carcinomas (HCC).

Secuencia

Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Forma física

Lyophilized from PBS buffer with 2% sucrose

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable