Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV36364

Sigma-Aldrich

Anti-CHD1L antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Chromodomain helicase DNA binding protein 1-like

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 9,619.00

MXP 9,619.00

Check Cart for Availability
Todas las fotos(1)

Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 9,619.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

MXP 9,619.00

Check Cart for Availability

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

45 kDa

reactividad de especies

mouse, rat, human, rabbit, pig

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_004275

Nº de acceso UniProt

Q9H678

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CHD1L(9557)

Inmunógeno

Synthetic peptide directed towards the middle region of human CHD1L

Acciones bioquímicas o fisiológicas

Chromodomain helicase DNA binding protein 1-like (CHD1L) is a DNA helicase and chromatin remodeling factor that is important in DNA repair. It converts ATP to poly (ADP-ribose) and regulates the chromatin relaxation during DNA repair. It has been identified as an oncogene that induces cell proliferation, apoptosis inhibition, G1/S phase transition and embryo development. CHD1L acts as a marker for prognosis of solid tumors such as hepatocellular carcinoma.[1]

Secuencia

Synthetic peptide located within the following region: DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC5832

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Jiyeon Hyeon et al.
Korean journal of pathology, 47(1), 9-15 (2013-03-14)
The gene for chromodomain helicase/ATPase DNA binding protein 1-like (CHD1L) was recently identified as a target oncogene within the 1q21 amplicon, which occurs in 46% to 86% of primary hepatocellular carcinoma (HCC) cases. However, the prognostic significance of CHD1L in
Wen Cheng et al.
Molecular cancer, 12(1), 170-170 (2013-12-24)
Comprehensive sequencing efforts have revealed the genomic landscapes of common forms of human cancer and  - 140 driver genes have been identified, but not all of them have been extensively investigated. CHD1L (chromodomain helicase/ATPase DNA binding protein 1-like gene) or
Alyssa C Snider et al.
Biology open, 2(2), 121-131 (2013-02-23)
During preimplantation development, the embryo must establish totipotency and enact the earliest differentiation choices, processes that involve extensive chromatin modification. To identify novel developmental regulators, we screened for genes that are preferentially transcribed in the pluripotent inner cell mass (ICM)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico