Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV35126

Sigma-Aldrich

Anti-KCNAB1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Potassium voltage-gated channel, shaker-related subfamily, β member 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 10,938.00

MXP 10,938.00


Fecha estimada de envío29 de mayo de 2025



Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 10,938.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

MXP 10,938.00


Fecha estimada de envío29 de mayo de 2025


origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

46 kDa

reactividad de especies

rat, dog, bovine, mouse, human, rabbit, guinea pig, horse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... KCNAB1(7881)

Descripción general

KCNAB1 codes for a member of potassium voltage-gated channel (shaker-related) protein subfamily. KCNAB1 forms a β subunit and associates with α subunits to form heteromeric complexes that modulate pore formation. Genetic variations in KCNAB1 have been linked to lateral temporal epilepsy.
Rabbit Anti-KCNAB1 antibody recognizes rabbit, canine, human, mouse, rat, chicken, pig, bovine, and zebrafish KCNAB1.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human KCNAB1

Aplicación

Rabbit Anti-KCNAB1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNAB1 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily.

Secuencia

Synthetic peptide located within the following region: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Giorgia Busolin et al.
Epilepsy research, 94(1-2), 110-116 (2011-02-22)
The KCNAB1 gene is a candidate susceptibility factor for lateral temporal epilepsy (LTE) because of its functional interaction with LGI1, the gene responsible for the autosomal dominant form of LTE. We investigated association between polymorphic variants across the KCNAB1 gene

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico