Saltar al contenido
Merck
Todas las fotos(5)

Documentos clave

AV32537

Sigma-Aldrich

Anti-POU2F3 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-POU domain, class 2, transcription factor 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

47 kDa

reactividad de especies

guinea pig, dog, rabbit, human, rat, sheep, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... POU2F3(25833)

Descripción general

POU2F3, also known as Skn-1a and OCT11, gene is mapped to human chromosome 11q23.3. The gene codes for a keratinocyte-specific POU transcription factor. The protein is expressed in stratified squamous epithelia, including the epidermis, cervix and foreskin.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human POU2F3

Aplicación

Rabbit Anti-POU2F3 antibody can be used for western blotting applications at a concentration of 0.5μg/ml. It can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.

Acciones bioquímicas o fisiológicas

POU2F3 is a transcription factor that is involved in the growth and differentiation of keratinocytes. Studies have reported that Pou2f3 (Skn-1a) is involved in the differentiation of chemosensory cells. Furthermore, this transcription factor is also required for specifying the lineage of taste receptor cells.

Secuencia

Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Makoto Ohmoto et al.
Bioscience, biotechnology, and biochemistry, 77(10), 2154-2156 (2013-10-08)
Solitary chemosensory cells in the non-neuronal epithelium of the anterior nasal cavity have bitter taste cell-like molecular characteristics and are involved in the detection of noxious substances. Here, we demonstrate that Pou2f3/Skn-1a, which is necessary for generation of sweet, umami
Monika I Hollenhorst et al.
Respiratory research, 24(1), 267-267 (2023-11-05)
Airway tuft cells, formerly called brush cells have long been described only morphologically in human airways. More recent RNAseq studies described a chemosensory cell population, which includes tuft cells, by a distinct gene transcription signature. Yet, until which level in
Ichiro Matsumoto et al.
Nature neuroscience, 14(6), 685-687 (2011-05-17)
Functional diversification of taste cells is crucial for proper discrimination of taste qualities. We found the homeodomain protein Skn-1a (Pou2f3) to be expressed in sweet, umami and bitter taste cells. Skn-1a-deficient mice lacked electrophysiological and behavioral responses to sweet, umami
Z Zhang et al.
Oncogene, 25(39), 5436-5445 (2006-04-12)
POU2F3 (OCT11, Skn-1a) is a keratinocyte-specific POU transcription factor whose expression is tied to squamous epithelial stratification. It is also a candidate tumor suppressor gene in cervical cancer (CC) because it lies in a critical loss of heterozygosity region on

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico