AV31910

Anti-GTF2I antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-General transcription factor II, i
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 110 kDa
• reactividad de especies: rat, rabbit, dog, human, guinea pig, horse, mouse, bovine
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_127492
• Nº de acceso UniProt: Q75M86
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... GTF2I(2969)

Descripción

Descripción general

GTF2I is a phosphoprotein transcription factor that has six typical repeat motifs. Mutations in this gene have been implicated in Williams Syndrome.
Rabbit Anti-GTF2I antibody recognizes chicken, rat, mouse, bovine, human, and canine GTF2I.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human GTF2I

Aplicación

Rabbit Anti-GTF2I antibody can be used for western blot (0.5μg/ml) and IHC (4-8μg/ml, using paraffin-embedded tissues) assays.

Acciones bioquímicas o fisiológicas

GTF2I encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. The exon(s) encoding 5′ UTR has not been fully defined, but this gene is known to contain at least 34 exons, and its alternative splicing generates 4 transcript variants.

Secuencia

Synthetic peptide located within the following region: ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable