AV02065

Anti-TNFRSF10A antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Tumor necrosis factor receptor superfamily, member 10a
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 50 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_003835
• UniProt accession no.: O00220
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TNFRSF10A(8797)

Descripción

Immunogen

The immunogen for anti-TNFRSF10A antibody: synthetic peptide derected towards the C terminal of human TNFRSF10A

Application

Anti-TNFRSF10A antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

TNFRSF10A or Death receptor 4 is a mediator of apoptosis and tumor suppression. Mutation in TNFRSF10A gene or dysfunction of the receptor results in tumor development and invasion. Polymorphism of Glu228Ala residue in TNFRSF10A is identified as a risk factor in metastatic prostate cancer after radiation therapy.

Sequence

Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable