Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

APREST71199

Sigma-Aldrich

PrEST Antigen SLC27A4

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Sinónimos:

ACSVL4, FATP4

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352202

recombinante

expressed in E. coli

Ensayo

>80% (SDS-PAGE)

Formulario

buffered aqueous solution

mol peso

predicted mol wt 27 kDa

purificado por

immobilized metal affinity chromatography (IMAC)

concentración

≥0.5 mg/mL

secuencia del inmunógeno

LLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTG

Ensembl | nº de acceso humano

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... SLC27A4(10999)

Descripción general

Recombinant protein fragment of Human SLC27A4 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Aplicación

Suitable as a blocking agent using corresponding antibodies.

Ligadura / enlace

Corresponding Antibody HPA007293.

Forma física

Solution in 1 M urea-PBS, pH 7.4

Nota de preparación

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Información legal

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.

Si necesita más asistencia, póngase en contacto con Atención al cliente

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico