Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

APREST70267

Sigma-Aldrich

PrEST Antigen PIGR

Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352202

recombinante

expressed in E. coli

Ensayo

>80% (SDS-PAGE)

Formulario

buffered aqueous solution

mol peso

predicted mol wt 32 kDa

purificado por

immobilized metal affinity chromatography (IMAC)

concentración

≥0.5 mg/mL

secuencia del inmunógeno

LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHS

Ensembl | nº de acceso humano

ENSG00000162896

Nº de acceso UniProt

P01833

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... PIGR(5284)

Descripción general

Recombinant protein fragment of Human PIGR with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Aplicación

Suitable as a blocking agent using corresponding antibodies.

Ligadura / enlace

Corresponding Antibody HPA012012.

Forma física

Solution in 1 M urea-PBS, pH 7.4

Nota de preparación

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Información legal

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.

Si necesita más asistencia, póngase en contacto con Atención al cliente

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Paolo Trevisi et al.
PloS one, 8(11), e81473-e81473 (2013-11-16)
To date few studies have addressed the development and function of the porcine gastric mucosal immune system and this is a major limitation to understanding the immunopathogenesis of infections occurring in young pigs. The polymeric immunoglobulin receptor (pIgR) mediates the

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico