Skip to Content
Merck
All Photos(1)

Key Documents

WH0000521M1

Sigma-Aldrich

Monoclonal Anti-ATP5I antibody produced in mouse

clone 1E6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E, Anti-ATP5K, Anti-MGC12532

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1E6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG2aκ

GenBank accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ATP5I(521)

General description

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the F0 complex. (provided by RefSeq)
ATP5I (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E) codes for components of the ATP synthase (complex V). This gene is located on human chromosome 4p16.

Immunogen

ATP5I (AAH03679, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK

Biochem/physiol Actions

ATP5I (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E) participates in the glucose-induced insulin secretion cascade of pancreatic beta-cells.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Frequent loss of genome gap region in 4p16. 3 subtelomere in early-onset type 2 diabetes mellitus.
Kudo H, et al.
Experimental Diabetes Research, 2011 (2011)
Mitochondrial dysregulation and oxidative stress in patients with chronic kidney disease.
Granata S, et al.
BMC Genomics, 10(1), 388-388 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service