Skip to Content
Merck
All Photos(2)

Key Documents

SAB1412513

Sigma-Aldrich

ANTI-SMAD6 antibody produced in mouse

clone 4F3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

HsT17432, MADH6, MADH7, SMAD6

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Product SAB1412513 is not currently sold in your country. Contact Technical Service

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4F3, monoclonal

form

buffered aqueous solution

mol wt

antigen 36.74 kDa

species reactivity

human

technique(s)

immunohistochemistry: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SMAD6(4091)

Related Categories

General description

SMAD family member 6 (SMAD6) is encoded by the gene mapped to human chromosome 15q22.31. The encoded protein is localized in both nuclei and cytoplasm and is expressed in variety of human tissues, including ovary. SMAD6 consists of MAD homology 2 (MH2) domain involved in protein-protein interaction.
The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila ‘ mothers against decapentaplegic ′ (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen

SMAD6 (NP_005576, 285 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR

Biochem/physiol Actions

SMAD family member 6 (SMAD6) induces endocytosis and negatively regulates apoptosis by inhibiting transforming growth factor-β (TGF-β) signaling pathway. In addition, it also indirectly regulates stemness by inhibiting erythropoiesis in cord blood hematopoietic stem cells (HSCs). Mutation in the gene leads to congenital cardiovascular malformation (CVM). Elevated expression/genetic variation of SMAD6 is associated with the development of ovarian cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Statistical genetic analysis of serological measures of common, chronic infections in Alaska Native participants in the GOCADAN study.
Rubicz R
Genetic Epidemiology, 37(7), 751-757 (2013)
Genetic variants in TGF-? pathway are associated with ovarian cancer risk.
Yin J
PLoS ONE, 6(9), 1-7 (2011)
Hao Lin et al.
Annals of translational medicine, 9(5), 384-384 (2021-04-13)
Activation of pancreatic stellate cells (PSCs) is a key cause of chronic pancreatitis (CP), while inhibition of transforming growth factor-β (TGF-β) signaling renders PSCs inactive. Inhibitory Smads (I-Smads) impede TGF-β intracellular signaling and may provide a way to alleviate CP.
Nonsynonymous variants in the SMAD6 gene predispose to congenital cardiovascular malformation.
Tan HL
Human Mutation, 33(4), 720-727 (2012)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service