Skip to Content
Merck
All Photos(6)

Key Documents

HPA036119

Sigma-Aldrich

Anti-CHMP7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CHMP family, member 7, Anti-MGC29816

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

LALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CHMP7(91782)

General description

The gene CHMP7 (charged multivesicular body protein 7) is mapped to human chromosome 8p. The encoded protein has an SNF7 (sucrose non-fermenting protein 7) domain and a distantly SNF7-related domain. It belongs to the CHMP family of proteins.

Immunogen

CHMP family, member 7 recombinant protein epitope signature tag (PrEST)

Application

Anti-FGF19 antibody produced in rabbit has been used for western blotting.

Biochem/physiol Actions

CHMP7 (charged multivesicular body protein 7) is a CHMP4-associated ESCRT-III (endosomal sorting complex required for transport)-related protein. It might have a role in endosomal sorting. During nuclear envelope formation, it participates in the recruitment of ESCRT-III to the envelope. The amino terminal tandem winged helix (WH)-domains allow CHMP7 association with endoplasmic reticulum and thereby help in ESCRT-III recruitment to nuclear envelope. Mutations in the CHMP7 gene prevent proper post-mitotic nucleo-cytoplasmic compartmentalization.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76258.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

CHMP7, a novel ESCRT-III-related protein, associates with CHMP4b and functions in the endosomal sorting pathway.
Horii M
The Biochemical Journal, 400(1), 23-32 (2006)
Joshua J Elacqua et al.
PloS one, 13(4), e0195664-e0195664 (2018-04-13)
Recent in vitro and in vivo studies have highlighted the importance of the cell nucleus in governing migration through confined environments. Microfluidic devices that mimic the narrow interstitial spaces of tissues have emerged as important tools to study cellular dynamics
LEM2 recruits CHMP7 for ESCRT-mediated nuclear envelope closure in fission yeast and human cells.
Gu M
Proceedings of the National Academy of Sciences of the USA, 114(11), E2166-E2175 (2017)
Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
Vietri M
Nature, 522(7555), 231-235 (2015)
Membrane Binding by CHMP7 Coordinates ESCRT-III-Dependent Nuclear Envelope Reformation.
Olmos Y
Current Biology, 26(19), 2635-2641 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service