Skip to Content
Merck
All Photos(6)

Key Documents

HPA007354

Sigma-Aldrich

Anti-MFAP2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-MAGP antibody produced in rabbit, Anti-MAGP-1 antibody produced in rabbit, Anti-MFAP-2 antibody produced in rabbit, Anti-Microfibril-associated glycoprotein antibody produced in rabbit, Anti-Microfibrillar-associated protein 2 precursor antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
MXP 11,020.00

MXP 11,020.00


Check Cart for Availability


Select a Size

Change View
100 μL
MXP 11,020.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

MXP 11,020.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

QYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MFAP2(4237)

General description

MFAP2 (microfibrillar-associated protein 2) protein is found to be expressed in the stroma and extracellular matrix of blood vessels, lung, muscle, skin and among other tissues. The gene is localized to human chromosome 1p36.1-p35.

Immunogen

Microfibrillar-associated protein 2 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-MFAP2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

MFAP2 (microfibrillar-associated protein 2) gene encodes a secreted protein that forms a component of the elastin-associated microfibrils. It is involved in cell-associated and matrix-associated functions. It is capable of binding to fibrillin-1 and fibrillin-2 that are part of the extracellular microfibrils. It functions in the binding and activation of αvβ3 integrins and modulates Notch signaling. Overexpression of this protein has been associated with poor prognosis in a study of human papillary serous ovarian carcinomas. It is found to promote the progression of ovarian cancer through its pro-angiogenic activity.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86580

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Alison Miyamoto et al.
Matrix biology : journal of the International Society for Matrix Biology, 40, 27-33 (2014-08-26)
MAGP2 is a small extracellular protein with both tumor angiogenesis and cell signaling activity. MAGP2 was originally isolated biochemically from microfibril-rich connective tissue. The localization of MAGP2 to microfibrils has been confirmed by both immunohistochemistry and immunogold electron microscopy. Whether
F Segade et al.
Matrix biology : journal of the International Society for Matrix Biology, 19(7), 671-682 (2000-12-05)
The human MAGP1 (or MFAP2) and mouse Magp1 genes code for the microfibril-associated glycoprotein-1 (MAGP-1), an extracellular matrix protein of microfibrillar structures. We report a revised 5' genomic structure including the use of a single transcription start site that gives

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service