Skip to Content
Merck
All Photos(1)

Key Documents

AV46808

Sigma-Aldrich

Anti-MMP23B antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MIFR, Anti-MIFR-1, Anti-MMP22, Anti-Matrix metallopeptidase 23B

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

36 kDa

species reactivity

guinea pig, bovine, human, mouse, dog, rat, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... MMP23B(8510)

Immunogen

Synthetic peptide directed towards the N terminal region of human MMP23B

Application

Anti-MMP23B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

MMP23B (matrix metallopeptidase 23B) gene encodes a single-pass type II membrane protein that belongs to matrix metalloproteinase (MMP) family and is expressed primarily in ovary, testis and prostate. Matrix metalloproteinase (MMP) family proteins facilitate the breakdown of extracellular matrix (ECM) components as well as processes cytokines and growth factors. Human MMP23B stimulates TNF shedding in a cell culture system. In zebrafish, Mmp23b plays a crucial role in augmenting liver development and hepatocyte proliferation via tumor necrosis factor pathway.

Sequence

Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Fei Qi et al.
Hepatology (Baltimore, Md.), 52(6), 2158-2166 (2010-11-11)
The matrix metalloproteinase (MMP) family of proteins degrades extracellular matrix (ECM) components as well as processes cytokines and growth factors. MMPs are involved in regulating ECM homeostasis in both normal physiology and disease pathophysiology. Here we report the critical roles
G Velasco et al.
The Journal of biological chemistry, 274(8), 4570-4576 (1999-02-13)
A cDNA encoding a new human matrix metalloproteinase (MMP), tentatively called MMP-23, has been cloned from an ovary cDNA library. This protein exhibits sequence similarity with MMPs, but displays a different domain structure. Thus, MMP-23 lacks a recognizable signal sequence

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service