AV32797

Anti-SCD antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Stearoyl-CoA desaturase (δ-9-desaturase)
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 41 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_005054
• UniProt accession no.: O00767
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SCD(6319)

Description

General description

Rabbit polyclonal anti-SCD antibody reacts with human and bovine stearoyl-CoA desaturases.

Stearoyl-CoA desaturase (SCD) is a rate-limiting enzyme that catalyses the conversion of saturated fatty acids to monounsaturated fatty acids (MUFA). SCD functions as a homeostatic check-point between glucose and fatty acid metabolism. It is a key enzyme target in the search for potential drugs to manage obesity.

Immunogen

Synthetic peptide directed towards the middle region of human SCD

Application

Rabbit Anti-SCD antibody can be used for western blot applications at a concentration of 1.0 μg/ml. It can also be used for IHC at 4-8 μg/ml, using paraffin-embedded tissues.

Rabbit polyclonal anti-SCD antibody is used to tag stearoyl-CoA desaturase for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of stearoyl-CoA desaturases in the homeostasis of fatty acid metabolism at the level of monounsaturation.

Biochem/physiol Actions

Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

Sequence

Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable