AMAB91812

Anti-CALB2 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL12836, purified by using Protein A, buffered aqueous glycerol solution

• Synonym(s): CAL2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody product type: primary antibodies
• clone: CL12836, monoclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• purified by: using Protein A
• species reactivity: human, mouse
• enhanced validation: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunohistochemistry: 1:1000-1:2500 ; western blot: 1 μg/mL
• isotype: IgG1
• Ensembl | human accession no.: ENSG00000172137
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... CALB2(794)

Description

Immunogen

Calbindin 2

Application

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Features and Benefits

All Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Sequence

MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKY

Linkage

Corresponding Antigen APREST70179

Physical form

The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Storage and Stability

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1