SAB2106562

Anti-PCDH10 antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 115 kDa
• species reactivity: mouse, human, bovine, dog, guinea pig, rabbit, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_001098170
• UniProt accession no.: E9PXQ7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PCDH10(57575) ; mouse ... Pcdh10(18526)

Description

Immunogen

The immunogen for anti-PCDH10 antibody: synthetic peptide derected towards the C terminal of human PCDH10

Biochem/physiol Actions

Pcdh10 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Sequence

Synthetic peptide located within the following region: PSDGRQAADYRSNLHVPGMDSVPDTEVFEPPEVQPGAERSFSTFGKEKAL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable