Skip to Content
Merck
All Photos(5)

Key Documents

HPA010698

Sigma-Aldrich

Anti-ATP1B2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Sodium/potassium- dependent ATPase subunit beta-2, Anti-Sodium/potassium-transporting ATPase subunit beta-2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50-1:200

immunogen sequence

TVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDST

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ATP1B2(482)

General description

ATP1B2 (ATPase, Na+/K+ transporting, β 2 polypeptide) gene encodes a member of the family of Na+/K+ and H+/K+ ATPases β chain proteins, and a subfamily of Na+/K+ -ATPases. The basic Na+/K+ -ATPase contains a catalytic α subunit and an N-glycosylated β subunit that participates in maturation and membrane targeting of the enzyme. The α subunit is present in four isoforms (α1, α2, α3 and α4) and the β-subunit comprises three isoforms (β1, β2, and β3). ATP1B2, the β2 subunit gene, consists of seven exons interspaced by six introns.

Immunogen

Sodium/potassium-transporting ATPase subunit beta-2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The Na+/K+ -ATPase (NKA) is a transmembrane carrier that plays an essential role in establishing and maintaining the electrochemical gradients of Na+ and K+ ions across the plasma membrane. This gradient facilitates osmoregulation, transport of several molecules, hydronium transport and energy metabolism, and electrical excitability of nerve and muscle. The β2 subunit encoded by ATP1B2 (ATPase, Na+/K+ transporting, β 2 polypeptide) gene functions in the maintenance of the stability of NKA and inhibits decrease in NKA activity under stress response. This subunit is also involved in the regulation of the number of sodium pumps transported to the plasma membrane.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71901

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ting-Fang Chen et al.
Protein expression and purification, 37(1), 47-52 (2004-08-06)
Na+, K+-ATPase beta2 subunit (NKA1b2) is not only a regulator of Na+, K+-ATPase, but also functions in the interaction between neuron and glia cells as a Ca2+-dependent adhesion molecule. To further study the function of NKA1b2, the anti-NKA1b2 polyclonal antibody
Florian Hilbers et al.
Scientific reports, 6, 20442-20442 (2016-02-06)
The vital gradients of Na(+) and K(+) across the plasma membrane of animal cells are maintained by the Na,K-ATPase, an αβ enzyme complex, whose α subunit carries out the ion transport and ATP hydrolysis. The specific roles of the β
J Avila et al.
Gene, 208(2), 221-227 (1998-04-03)
We cloned and characterized the human Na,K-ATPase beta 2-subunit gene. The gene encompasses over 8 kb at chromosome 17 in the human genome and is composed of seven exons. Primer extension analysis identified a major transcription initiation site 529 bases
Zeying Wang et al.
Molecular biology reports, 38(3), 1749-1755 (2010-09-16)
Genetic association analysis was applied to examine the effect of the Na(+)/K(+)-ATPase beta 2 subunit (ATP1B2) gene on rectal temperature, milk traits, K(+) levels and Na(+)/K(+)-ATPase (NKA) activity in the red blood cells of 1001 Chinese Holstein cows under normal
Anca Stoica et al.
Glia, 65(11), 1777-1793 (2017-08-09)
Synaptic activity results in transient elevations in extracellular K+ , clearance of which is critical for sustained function of the nervous system. The K+ clearance is, in part, accomplished by the neighboring astrocytes by mechanisms involving the Na+ /K+ -ATPase.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service