Skip to Content
Merck
All Photos(1)

Documents

SAB1400142

Sigma-Aldrich

Monoclonal Anti-IL15 antibody produced in mouse

clone 1G3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-IL15, Anti-MGC9721

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1G3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG2bκ

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IL15(3600)

General description

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other′s activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. (provided by RefSeq)

Immunogen

IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein.

Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Biochem/physiol Actions

Interleukin-15 (IL-15) stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. It exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells. On binding to its receptor, IL-15 is indirectly involved in activating proto-oncogenes. Increased expression of IL-15 has been implicated with rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis and diseases affiliated with retroviruses like human immunodeficiency virus (HIV) and human T-lymphotropic virus-1 (HTLV-I).

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Huaqin Yuan et al.
Neoplasia (New York, N.Y.), 17(5), 410-420 (2015-05-31)
Intrarenal interleukin-15 (IL-15) plays a major role controlling epithelial survival and polarization both in physiological and pathologic conditions. Herein, we confirmed that human renal cell carcinomas (RCCs) express a membrane-bound IL-15 isoform displaying an unusual molecular weight of 27 kDa.
Anjali Mishra et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 20(8), 2044-2050 (2014-04-17)
Interleukin-15 (IL-15) is a proinflammatory cytokine involved in the development, survival, proliferation, and activation of multiple lymphocyte lineages utilizing a variety of signaling pathways. IL-15 utilizes three distinct receptor chains in at least two different combinations to signal and exert
Patricia K A Mongini et al.
Journal of immunology (Baltimore, Md. : 1950), 195(3), 901-923 (2015-07-03)
Clinical progression of B cell chronic lymphocytic leukemia (B-CLL) reflects the clone's Ag receptor (BCR) and involves stroma-dependent B-CLL growth within lymphoid tissue. Uniformly elevated expression of TLR-9, occasional MYD88 mutations, and BCR specificity for DNA or Ags physically linked
Bieke Broux et al.
Journal of immunology (Baltimore, Md. : 1950), 194(5), 2099-2109 (2015-01-27)
CD4(+)CD28(-) T cells arise through repeated antigenic stimulation and are present in diseased tissues of patients with various autoimmune disorders, including multiple sclerosis (MS). These cells are believed to have cytotoxic properties that contribute to the pathogenic damaging of the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service