Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

HPA005539

Sigma-Aldrich

Anti-KANK1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ANKRD15, Anti-Ankyrin repeat domain-containing protein 15 antibody produced in rabbit, Anti-Kidney ankyrin repeat-containing protein

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

INVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KANK1(23189)

General description

KN motif and ankyrin repeat domains 1 (KANK1) is an adaptor protein, which belongs to the KANK family of proteins. It contains ankyrin-repeat domain at its C-terminus, central coiled coil domains, and the KN motif at the N-terminal. KANK1 gene is located at the chromosomal position 9p24.3. This protein is found in both cytoplasm and nucleus, though it is predominantly found in the cytoplasm in multiple human kidney cell lines. Alternative splicing of this gene produces two isoforms, KANK-L and KANK-S, where KANK-L has an additional 158 amino acid at the N-terminal.

Immunogen

KN motif and ankyrin repeat domain-containing protein 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-KANK1 antibody is suitable for immunoprecipitation and pull-down assay.
Anti-KANK1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

KANK1 (KN motif and ankyrin repeat domains 1) protein regulates the formation of cytoskeleton by mediating actin polymerization. Akt phosphorylates KANK1, which in turn binds to 14-3-3 protein. The activation of Akt is dependent upon epidermal growth factor (EGF) and insulin, which control cell migration, apoptosis, cell cycle and growth etc. Through Akt signaling, KANK1 suppresses cell migration and actin stress fiber formation by inhibiting RhoA. It prevents the formation of lamellipodia in fibroblasts via its interaction with IRSp53. It also negatively regulates integrin dependent cell spreading. KANK1 acts as a nucleo-cytoplasmic shuttle for β-catenin protein, where β-catenin is transported to nucleus to induce transcription dependent on β-catenin. KANK1 also acts as a tumor suppressor gene, and its down-regulation or inactivation is associated with kidney cancer, prostate cancer, lung cancer, bladder cancer, and breast cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85227

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service