Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

AV13107

Sigma-Aldrich

Anti-RAB14 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-RAB14, member RAS oncogene family

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

24 kDa

species reactivity

rat, goat, human, pig, bovine, mouse, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RAB14(51552)

Immunogen

Synthetic peptide directed towards the C terminal region of human RAB14

Application

Anti-RAB14 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Biochem/physiol Actions

RAB14 is a member of Rab GTPases that regulate the roles and identity of endosomes. Rab14 collaborates with FAM116 in regulating proteolytic cleavage of N-cadherin, and modulation of cell-cell adhesion and cell motility. Rab14 mediates the endocytic transport of GLUT4 from cytoplasmic compartments to cell surface.

Sequence

Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rytis Prekeris
Developmental cell, 22(5), 909-910 (2012-05-19)
Linford et al. define a Rab14-mediated endocytic recycling pathway that controls proteolytic N-cadherin cleavage by transporting ADAM10 protease to the plasma membrane. When this pathway is disrupted, diminished ADAM10-dependent N-cadherin shedding leads to increased cell-cell adhesion and inhibition of cell
Sam E Reed et al.
Journal of cell science, 126(Pt 9), 1931-1941 (2013-02-28)
Insulin enhances the uptake of glucose into adipocytes and muscle cells by promoting the redistribution of the glucose transporter isoform 4 (GLUT4) from intracellular compartments to the cell surface. Rab GTPases regulate the trafficking itinerary of GLUT4 and several have
Andrea Linford et al.
Developmental cell, 22(5), 952-966 (2012-05-19)
Rab GTPases define the vesicle trafficking pathways underpinning cell polarization and migration. Here, we find that Rab4, Rab11, and Rab14 and the candidate Rab GDP-GTP exchange factors (GEFs) FAM116A and AVL9 are required for cell migration. Rab14 and its GEF

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service