Skip to Content
Merck
All Photos(3)

Key Documents

SAB2102370

Sigma-Aldrich

Anti-TAP1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-ABC17, Anti-ABCB2, Anti-APT1, Anti-D6S114E, Anti-Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

87 kDa

species reactivity

human, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TAP1(6890)

General description

The transporter protein associated with antigen processing-1 (TAP1) belongs to the major histocompatibility complex (MHC) class I peptide-loading complex. TAP1 is also termed as the partner of sld five 1 (PSF1). PSF1 belongs to the heterotetrameric complex, known as GINS. It is located on human chromosome 6p21.

Immunogen

Synthetic peptide directed towards the middle region of human TAP1

Application

Anti-TAP1 antibody has been used in immunoprecipitation.

Biochem/physiol Actions

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). TAP1 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. TAP1 is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.
Knockdown of PSF1 expression blocks the multiplication of cell in lung cancer cells in vitro.

Sequence

Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Knockdown of PSF1 expression inhibits cell proliferation in lung cancer cells in vitro
Zhang J, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 36(3), 2163-2168 (2015)
Lital Sever et al.
Developmental and comparative immunology, 81, 262-270 (2017-12-19)
Major histocompatibility complex (MHC) class I receptors play a key role in the immune system by presenting non-self peptides to T cell lymphocytes. In humans, the assembly of the MHC class I with a peptide is mediated by machinery in
Tapasin's protein interactions in the rainbow trout peptide-loading complex
Sever L, et al.
Developmental and Comparative Immunology, 81, 262-270 (2018)
Polymorphisms in inflammation genes (angiotensinogen, TAP1 and TNF-beta) in psoriasis
Vasku V, et al.
Archives of Dermatological Research, 292(11), 531-534 (2000)
Interferon alpha signalling and its relevance for the upregulatory effect of transporter proteins associated with antigen processing (TAP) in patients with malignant melanoma
Heise R, et al.
PLoS ONE, 11(1), e0146325-e0146325 (2016)

Articles

Protein-based drug transporters are expressed in Sf9 cells. Understanding the specific mechanisms of tumor cell transporters is an essential aspect of chemotherapeutic drug design.

Protein-based drug transporters are expressed in Sf9 cells. Understanding the specific mechanisms of tumor cell transporters is an essential aspect of chemotherapeutic drug design.

Protein-based drug transporters are expressed in Sf9 cells. Understanding the specific mechanisms of tumor cell transporters is an essential aspect of chemotherapeutic drug design.

Protein-based drug transporters are expressed in Sf9 cells. Understanding the specific mechanisms of tumor cell transporters is an essential aspect of chemotherapeutic drug design.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service