Skip to Content
Merck
All Photos(3)

Key Documents

HPA030817

Sigma-Aldrich

Anti-YKT6 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

Synonym(s):

Anti-YKT6 v-SNARE homolog (S. cerevisiae)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQ

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... YKT6(10652)

General description

YKT6 v-SNARE homolog (soluble N-ethylmaleimide-sensitive factor attachment protein receptor proteins) is also called synaptobrevin homolog YKT6. The gene YKT6 is located on human chromosome 7p13. The C-terminal ofYKT6 has the SNARE binding domain and the N-terminal has longin domain which adopts to profilin-like fold. Both domains are critical for functionality of YKT6.

Immunogen

YKT6 v-SNARE homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-YKT6 antibody produced in rabbit has been in western blotting.

Biochem/physiol Actions

Synaptobrevin homolog YKT6 mobilises transport events between endoplasmic reticulum, golgi and endosomes. The longin domain of YKT6 mediates protein targeting to neurons and is critical for proper neuronal function.Palmitoylation of YKT6 is critical for its functionality. Farnesylation of YKT6 modulates its SNARE functionality and membrane association.YKT6 is highly expressed in breast and downregulated in lung cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78464

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions
Xu D, et al.
The Journal of Cell Biology, 217(3), 975-995 (2018)
The mammary gland-specific marsupial ELP and eutherian CTI share a common ancestral gene
Pharo EA, et al.
BMC Evolutionary Biology, 12(1), 80-80 (2012)
The human SNARE protein Ykt6 mediates its own palmitoylation at C-terminal cysteine residues
Michael V
The Biochemical Journal, 384(2), 233-237 (2004)
An autoinhibitory mechanism for nonsyntaxin SNARE proteins revealed by the structure of Ykt6p
Tochio H, et al.
Science, 293(5530), 698-702 (2001)
Longins and their longin domains: regulated SNAREs and multifunctional SNARE regulators
Rossi V, et al.
Trends in Biochemical Sciences, 29(12), 682-688 (2004)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service