Skip to Content
Merck
All Photos(5)

Key Documents

WH0001104M1

Sigma-Aldrich

Monoclonal Anti-RCC1 antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CHC1, Anti-RCC1I, Anti-regulator of chromosome condensation 1

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RCC1(1104)

General description

Regulator of chromosome condensation 1 (RCC1) is a nuclear guanine nucleotide exchange factor for the small GTPase Ran enzyme. The gene is located on human chromosome 1p35.3. It is a 45 kDa protein.

Immunogen

RCC1 (AAH07300, 312 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS

Biochem/physiol Actions

Regulator of chromosome condensation 1 (RCC1) interacts with chromatin and contributes to the formation of RanGTP gradients, which is required for nucleo-cytoplasmic transport, mitotic spindle formation and nuclear envelope reassembly following mitosis. It is an important cell cycle regulator. The protein functions as a tumor suppressor in gastric carcinoma.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Methylation-silencing RCC1 expression is associated with tumorigenesis and depth of invasion in gastric cancer
Lin YL, et al.
International Journal of Clinical and Experimental Pathology, 8(11), 14257-14257 (2015)
Epstein-Barr virus nuclear antigen 1 interacts with regulator of chromosome condensation 1 dynamically throughout the cell cycle
Deschamps T, et al.
The Journal of General Virology, 98(2), 251-265 (2017)
Integrated analysis profiles of long non-coding RNAs reveal potential biomarkers of drug resistance in lung cancer
Xue WL, et al.
Oncotarget, 8(38), 62868-62868 (2017)
Nuclear import of the Ran exchange factor, RCC1, is mediated by at least two distinct mechanisms
Nemergut ME, et al.
The Journal of Cell Biology, 149(4), 835-850 (2000)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service