SAB1402301

Monoclonal Anti-PCP4 antibody produced in mouse

clone 1E3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): PEP-19
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1E3, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~32.93 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_006198
• UniProt accession no.: P48539
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PCP4(5121)

Description

General description

Purkinje cell protein 4 (PCP4) is an anti-apoptotic, calmodulin-binding peptide which is expressed in neural cells. It is also expressed in the Purkinje cells of the cerebellum, kidneys, prostate and the uterus. PCP4 is a 7.6kDa with an IQ-motif. The gene encoding this protein is localized on human chromosome 21q22.2.

Immunogen

PCP4 (NP_006189.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

Biochem/physiol Actions

Purkinje cell protein 4 (PCP4) may have a role in apoptosis and cellular degeneration. It acts as an accelerator of calcium association and disassociation with calmodulin. The protein also functions in synaptic plasticity.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable