Skip to Content
Merck
All Photos(2)

Key Documents

SAB1400666

Sigma-Aldrich

Monoclonal Anti-CIDEC antibody produced in mouse

clone 2E2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CIDE-3, Anti-FLJ20871, Anti-Fsp27

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2E2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CIDEC(63924)

Related Categories

General description

CIDEC (cell death inducing DFFA (DNA fragmentation factor subunit α) like effector c) is mapped to human chromosome 3p25.3. The gene codes for FSP27 (fat-specific protein 27), also known as CIDEC. The encoded protein is localized to the lipid droplets surface. The gene is predominantly expressed in white adipose tissues and also expressed in liver and kidney.

Immunogen

CIDEC (NP_071377.2, 53 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA

Biochem/physiol Actions

CIDEC (cell death inducing DFFA (DNA fragmentation factor subunit α) like effector c) might be responsible for adipocytes differentiation. It is involved in the regulation of lipid droplet morphology and controls the lipid droplets size by inhibiting lipolysis. It is responsible for the triglycerides buildup in adipocytes. Upregulation of the gene is observed in obesity. Overexpression of the gene decreases the fatty acid oxidation (FAO) rate.
Cell death-inducing DFFA-like effector protein C (CIDEC) has a role in the differentiation of adipocytes. It associates with 5′ adenosine monophosphate-activated protein kinase (AMPK) α subunit 1 and acts as a negative regulator of the AMPK complex. CIDEC is also involved in lipid storage and it modulates the size of lipid droplets. The protein has been linked to obesity.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ming-Jiang Xu et al.
Gastroenterology, 149(4), 1030-1041 (2015-06-24)
Alcoholic steatohepatitis (ASH) is the progressive form of alcoholic liver disease and may lead to cirrhosis and hepatocellular carcinoma. We studied mouse models and human tissues to identify molecules associated with ASH progression and focused on the mouse fat-specific protein
Frederic Reinier et al.
Metabolism: clinical and experimental, 64(11), 1530-1540 (2015-09-10)
Lipodystrophies are a large heterogeneous group of genetic or acquired disorders characterized by generalized or partial fat loss, usually associated with metabolic complications such as diabetes mellitus, hypertriglyceridemia and hepatic steatosis. Many efforts have been made in the last years
Bilal Haider Shamsi et al.
PloS one, 9(9), e106992-e106992 (2014-09-12)
Obesity is a metabolic disorder that can lead to high blood pressure, increased blood cholesterol and triglycerides, insulin resistance, and diabetes mellitus. The aim was to study the effects of pioglitazone mediated sensitization of peroxisome proliferator-activated receptor gamma (PPAR-γ) on
Ming Yu et al.
Molecular and cellular biochemistry, 378(1-2), 145-151 (2013-03-12)
Clear cell renal cell carcinoma (ccRCC) is the major and aggressive subtype of renal cell carcinoma. It is known to derive its histologic appearance from accumulation of abundant lipids and glycogens. The cell death-inducing DFF45-like effector (CIDE) family has been
Anna Vilà-Brau et al.
Journal of lipid research, 54(3), 592-601 (2012-12-12)
FSP27 [cell death-inducing DFFA-like effector c (CIDEC) in humans] is a protein associated with lipid droplets that downregulates the fatty acid oxidation (FAO) rate when it is overexpressed. However, little is known about its physiological role in liver. Here, we

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service