Synthetic peptide directed towards the N terminal region of human CEBPA
Application
Anti-CEBPA antibody produced in rabbit is suitable for western blotting at a concentration of 5 μg/ml.
Biochem/physiol Actions
CCAAT/enhancer binding proteins are involved in the regulation of genes involved in the differentiation of squamous epithelial cells. They have been reported to exhibit altered expression in skin neoplasms. CEB proteins also mediate the functional interaction of IL-6 and TNF-α in mouse embryonic fibroblasts.
Sequence
Synthetic peptide located within the following region: GGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of investigative dermatology, 110(6), 939-945 (1998-06-10)
The epidermis is a stratified squamous epithelium composed primarily of keratinocytes that undergo sequential changes in gene expression during differentiation. CCAAT/enhancer binding proteins (C/EBP) are members of the bZIP family of DNA binding proteins/transcription factors. Northern analysis demonstrated that C/EBPalpha
The Journal of biological chemistry, 279(4), 2559-2567 (2003-11-06)
Interleukin (IL)-17 is a recently described cytokine involved in the amplification of inflammatory responses and pathologies. A hallmark feature of IL-17 is its ability to induce expression of other cytokines and chemokines. In addition, IL-17 potently synergizes with tumor necrosis
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.