Skip to Content
Merck
All Photos(6)

Key Documents

HPA026816

Sigma-Aldrich

Anti-SEC11C antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-SEC11 homolog C (S. cerevisiae), Anti-SEC11L3, Anti-SPC21, Anti-SPCS4C

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SEC11C(90701)

General description

SEC11 homolog C (SEC11C), mapped to human chromosome 18, encodes signal peptidase complex subunit 21 (SPC21) protein. The encoded protein is characterized with two hydrophobic domains, one at amino terminal end between signal peptidase complex 18 (SPC 18) residues 17-57, which functions as a transmembrane anchor and other hydrophobic domain is mapped between SPC 18 residues 144 and 176.

Immunogen

SEC11 homolog C (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

Application

Anti-SEC11C antibody has been used in western blotting.
Anti-SEC11C antibody produced in rabbit has been used in western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

In gastric cancer, SPC18 (signal peptidase complex 18) protein, coded by SEC11C (SEC11 homolog C, signal peptidase complex subunit), helps in the development through TGF-α(transforming growth factor alpha)secretion. SPC proteins present in vitro may participate in the mechanism of signal peptide processing and protein translocation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70171

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A CRISPR screen defines a signal peptide processing pathway required by flaviviruses.
Zhang R, et al.
Nature, 535(7610), 164-164 (2016)
Signal peptidase complex 18, encoded by SEC11A, contributes to progression via TGF-a secretion in gastric cancer.
Oue N
Oncogene, 33(30), 3918-3926 (2014)
Two subunits of the canine signal peptidase complex are homologous to yeast SEC11 protein.
Shelness GS, Blobel G
The Journal of Biological Chemistry, 265(16), 9512-9519 (1990)
Paco Hulpiau et al.
Cellular and molecular life sciences : CMLS, 73(5), 1103-1116 (2015-09-18)
Paracaspases and metacaspases are two families of caspase-like proteins identified in 2000. Up until now paracaspases were considered a single gene family with one known non-metazoan paracaspase in the slime mold Dictyostelium and a single animal paracaspase called MALT1. Human
Rong Zhang et al.
Nature, 535(7610), 164-168 (2016-07-08)
Flaviviruses infect hundreds of millions of people annually, and no antiviral therapy is available. We performed a genome-wide CRISPR/Cas9-based screen to identify host genes that, when edited, resulted in reduced flavivirus infection. Here, we validated nine human genes required for

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service