Skip to Content
Merck
All Photos(2)

Key Documents

HPA018193

Sigma-Aldrich

Anti-NEK7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-NimA-related protein kinase 7, Anti-Serine/threonine-protein kinase Nek7

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

VCLLPVWERRVCALNACYFLEIIKGSESLQYMATLTNLFENLPVSHHGSFA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NEK7(140609)

General description

The gene never in mitosis A-related kinase-7 (NEK7) is mapped to human chromosome 1q31.3. This protein belongs to the NIMA-related family of serine/threonine kinases which are conserved and crucial regulators of mitosis and cilia formation. RT-PCR analysis showed NEK7 expression in tissues of lungs, muscle, testis, brain, heart, liver, leukocyte and spleen. NEK7 is located at the centrosome, as well as in the cytoplasm. The kinase activity of NEK7 oscillates during the cell cycle, reaching highest at M phase.

Immunogen

Serine/threonine-protein kinase Nek7 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Never in mitosis A-related kinase-7 (NEK7) is up-regulated in gallbladder carcinoma and is associated with shorter overall survival time. Absence of NEK7 results in microtubule dynamic instability inversed by NEK7 overexpression. NEK7 is important for proper spindle formation during mitosis. NEK7 is also involved in recruitment of centrosomal pericentriolar material proteins, which are essential for centriole duplication and spindle pole formation. NEK9, another NIMA family kinase activates NEK7 via phosphorylation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73508

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

R Wang et al.
Clinical & translational oncology : official publication of the Federation of Spanish Oncology Societies and of the National Cancer Institute of Mexico, 15(8), 626-632 (2013-01-30)
Gallbladder carcinoma (GC) is generally considered as a relatively rare malignancy with poor prognosis. In order to guide clinicians in selecting suitable treatment for GC patients, reliable markers predictive of poor clinical outcome are desirable. This study analyzed the expression
Sivan Cohen et al.
Biochimica et biophysica acta, 1833(5), 1104-1113 (2013-01-15)
The NIMA-related kinases (NRK or Nek) are emerging as conserved and crucial regulators of mitosis and cilia formation. The microtubule (MT) network has long been suspected as a major target of the Neks. However, the underlying mechanism remains unclear. Using
Sunghwan Kim et al.
Journal of cell science, 124(Pt 22), 3760-3770 (2011-11-22)
The centrosomes in dividing cells follow a series of cyclical events of duplication and separation, which are tightly linked to the cell cycle. Serine/threonine-protein kinase NEK7 (NEK7) is a centrosomal kinase that is required for proper spindle formation during mitosis.
M Kimura et al.
Cytogenetics and cell genetics, 94(1-2), 33-38 (2001-11-10)
Neks (NIMA-related kinase) are a group of protein kinases sharing high amino acid sequence identity with NIMA which controls initiation of mitosis in Aspergillus nidulans. We have identified and characterized human NEK7, a novel human gene structurally related to NIMA.
Christopher Belham et al.
The Journal of biological chemistry, 278(37), 34897-34909 (2003-07-04)
The Nek family of protein kinases in humans is composed of 11 members that share an amino-terminal catalytic domain related to NIMA, an Aspergillus kinase involved in the control of several aspects of mitosis, and divergent carboxyl-terminal tails of varying

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service