Skip to Content
Merck
All Photos(3)

Documents

SAB2108468

Sigma-Aldrich

Anti-FOXA3

affinity isolated antibody

Synonym(s):

Anti- HNF3G, Anti- TCF3G, Anti-FKHH3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

37 kDa

species reactivity

dog, guinea pig, rat, bovine, human

concentration

0.5-1 mg/mL

technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

accession no.

NM_004497

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOXA3(3171)

Related Categories

General description

Forkhead box A3 (FOXA3), also known as hepatocyte nuclear factor 3 γ (HNF3γ), is encoded by the gene mapped to human chromosome 19q13.32. The encoded protein belongs to the Foxa subfamily. FOXA3 is characterized with a homologous forkhead DNA-binding domain and two transcriptional activation domains located at the N- and C-terminal.

Immunogen

Synthetic peptide directed towards the middle region of human FOXA3

Biochem/physiol Actions

Forkhead box A3 (FOXA3) plays a vital role in maintenance of cell glucose homeostasis during prolonged fast. It is also implicated in the regulation of fat mass in humans. FOXA3 inhibits innate immunity and increases the risk of susceptibility to viral infections associated with chronic lung disorders accompanied by chronic goblet cell metaplasia.

Sequence

Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Analysis of variants and mutations in the human winged helix FOXA3 gene and associations with metabolic traits
Adler-Wailes DC, et al.
International journal of obesity (2005), 39, 888-892 (2015)
SnapShot: forkhead transcription factors I.
Tuteja G andKaestner KH.
Cell, 130, 1160-1160 (2007)
Foxa3 (hepatocyte nuclear factor 3gamma ) is required for the regulation of hepatic GLUT2 expression and the maintenance of glucose homeostasis during a prolonged fast.
Shen W, et al.
The Journal of Biological Chemistry, 276, 42812-42817 (2001)
Casandra Walker et al.
International journal of molecular sciences, 24(2) (2023-01-22)
Perinatal exposure to endocrine disrupting chemicals (EDCs) has been shown to affect male reproductive functions. However, the effects on male reproduction of exposure to EDC mixtures at doses relevant to humans have not been fully characterized. In previous studies, we
Foxa3 induces goblet cell metaplasia and inhibits innate antiviral immunity.
Chen G, et al.
American Journal of Respiratory and Critical Care Medicine, 189, 301-313 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service