Skip to Content
Merck
All Photos(7)

Key Documents

HPA012323

Sigma-Aldrich

Anti-CSF1R antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

CSF1R Antibody - Anti-CSF1R antibody produced in rabbit, Csf1R Antibody, Anti-CD115 antigen, Anti-CSF-1-R, Anti-Fms proto-oncogene, Anti-Macrophage colony-stimulating factor 1 receptor precursor, Anti-c-fms

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CSF1R(1436)

General description

CSF1R (Colony stimulating factor 1 receptor), a type III receptor tyrosine kinase, is a member of the platelet-derived growth factor (PDGF) receptor family. Structurally, it is composed of five immunoglobulin-like domains, a transmembrane domain, a juxtamembrane domain (JM) and a protein kinase domain separated into two parts by an insert domain (KID).
CSF1R is located on human chromosome 5q32.

Immunogen

Macrophage colony-stimulating factor 1 receptor precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-CSF1R antibody has been used:
  • in cell lysis
  • in immunoprecipitation
  • in western blotting
  • in immunohistochemical analysis

Biochem/physiol Actions

CSF1R (Colony stimulating factor 1 receptor) is a major molecule in the innate immunity, cancer, and inflammatory diseases, including systemic lupus erythematosus, arthritis, atherosclerosis and obesity. It regulates developmental activities including cell survival, proliferation, differentiation, and function of mononuclear phagocytes. It has been reported that CSF-1 autocrine loop helps to activate macrophages. In actual state, it exists as an autoinhibited form, and upon activation, it dimerizes. Later, it autophosphorylates tyrosine residues in the intracellular domain, followed by the recruitment of signaling molecules as well as internalization of the receptor. Mutation in the CSF1R causes several diseases including myeloid malignancies.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86535

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Multi-level whole genome analysis reveals candidate biomarkers in clear cell renal cell carcinoma
Girgis A H, et al.
Cancer research, canres-ca0656 (2012)
Xingchao Wang et al.
Frontiers in oncology, 12, 850767-850767 (2022-04-22)
Colony stimulating factor 1 receptor (CSF-1R) is a single channel III transmembrane receptor tyrosine kinase (RTK) and plays an important role in immune regulation and the development of various cancer types. The expression of CSF-1R in colon adenocarcinoma (COAD) and
Harvey I Pass et al.
Oncotarget, 7(35), 56408-56421 (2016-08-04)
In the present work we show that multiple lung cancer cell lines contain cisplatin resistant cell subpopulations expressing the Colony-Stimulating-Factor-Receptor-1 (CSF-1R) and surviving chemotherapy-induced stress. By exploiting siRNA-mediated knock down in vitro and the use of an investigational CSF-1R TKI
Muhammad Baghdadi et al.
Scientific reports, 8(1), 418-418 (2018-01-13)
Despite recent advances in diagnosis and treatment of lung cancers, the 5-year survival rate remains unsatisfactory, which necessitates the identification of novel factors that associates with disease progression and malignant degree for improving diagnostic and therapeutic strategies. Recent progress in
High co-expression of IL-34 and M-CSF correlates with tumor progression and poor survival in lung cancers
Baghdadi M, et al.
Scientific reports, 8(1), 418-418 (2018)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service