Skip to Content
Merck
All Photos(3)

Key Documents

AV44289

Sigma-Aldrich

Anti-PSEN2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-AD3L, Anti-AD4, Anti-PS2, Anti-Presenilin 2 (Alzheimer disease 4), Anti-STM2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

49 kDa

species reactivity

bovine, horse, human, dog, rat, guinea pig, rabbit, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PSEN2(5664)

Immunogen

Synthetic peptide directed towards the N terminal region of human PSEN2

Application

Anti-PSEN2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

Presenilin 2 (PSEN2; PS2; AD4) regulates the activity of γ-secretase, the enzyme that cleaves amyloid precursor protein (APP). Studies indicate that PSEN2 also might regulate the cleavage of Notch receptor that in turn regulates gamma-secretase activity. Presenilins regulate the release of neurotransmitters at the synapses and intracellular Ca+2 homeostasis. Mutations in gene encoding presenilins are linked to familial Alzheimer′s disease.

Sequence

Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tomoko Wakabayashi et al.
Physiology (Bethesda, Md.), 23, 194-204 (2008-08-14)
The presenilins in combination with other proteins generate different gamma-secretases, which are involved in the regulated intramembrane proteolysis of a variety of proteins. Understanding the specificity and regulation of these proteases will potentially lead to novel therapeutics for Alzheimer's disease
Bruno A Benitez et al.
PLoS genetics, 9(8), e1003685-e1003685 (2013-08-31)
The primary constituents of plaques (Aβ42/Aβ40) and neurofibrillary tangles (tau and phosphorylated forms of tau [ptau]) are the current leading diagnostic and prognostic cerebrospinal fluid (CSF) biomarkers for AD. In this study, we performed deep sequencing of APP, PSEN1, PSEN2
Andrea Pilotto et al.
BioMed research international, 2013, 689591-689591 (2014-01-01)
The discovery of monogenic forms of Alzheimer's Disease (AD) associated with mutations within PSEN1, PSEN2, and APP genes is giving a big contribution in the understanding of the underpinning mechanisms of this complex disorder. Compared with sporadic form, the phenotype
Bei Wu et al.
Proceedings of the National Academy of Sciences of the United States of America, 110(37), 15091-15096 (2013-08-07)
Presenilin (PS) plays a central role in the pathogenesis of Alzheimer's disease, and loss of PS causes progressive memory impairment and age-related neurodegeneration in the mouse cerebral cortex. In hippocampal neurons, PS is essential for neurotransmitter release, NMDA receptor-mediated responses
Christin Bissig et al.
Journal of cell science, 132(5) (2019-02-03)
The metabolism of PI(3,5)P2 is regulated by the PIKfyve, VAC14 and FIG4 complex, mutations in which are associated with hypopigmentation in mice. These pigmentation defects indicate a key, but as yet unexplored, physiological relevance of this complex in the biogenesis

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service